PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041202.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 631aa    MW: 71584.3 Da    PI: 6.1233
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041202.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS274.82.7e-842656282374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                   + Ll++Ae v  +++e+a++lL r +  as + +p+qR+++ f+eAL++r+ + +++++yk  + s+ s    s++l++  + ++  P++ + +++a
  Pbr041202.1 265 AHILLAAAEKVGYQQFERANRLLLRCEFAASFKVNPVQRVVFNFAEALRERIEKeTGNSMYKGNEISSYSL-GLSTNLTFI-ACHQDIPFHPVLQFAA 360
                  699***************************************************77888888777777763.244444443.466778********** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                   q Ile v+ e++vH iD++i  G+QW  L++ La+R+e p   l iT+vg    + k+++eetg+rLa++A++l+vpf+f+++++ ++ed++ + ++
  Pbr041202.1 361 IQVILENVALERKVHLIDLEIRSGVQWTGLMEVLAEREECPIeLLTITAVGV---TGKQKIEETGRRLASVAKALNVPFQFKAVIVADMEDVKKQLFD 455
                  **************************************7665499*******...68***************************************** PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  v+ +Ea++V   l l +l  ++ +le+    +++++++lsP v+vv e ea+hns+sF++rf++al yysa+fd+lea + +++e r  +Er  l++ 
  Pbr041202.1 456 VEDDEAVVVYAPLILRTLILRPSCLEN----LMRVMRNLSPCVMVVNEVEANHNSPSFVNRFIDALFYYSAFFDCLEACM-KHEESRLLMERL-LHEG 547
                  *******************99999999....***********************************************96.666778888887.**** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  i+n+va+eg+er+ r+ ++e Wr+ + ++ + ++++s+   +qa+l+ +k++s   +++ + ++l+ gWk+ p+ s+SaW+
  Pbr041202.1 548 IRNIVAAEGSERVTRNVKMEVWRAFFARFRMVEINFSKASLNQASLVAKKFGSPSCTLHRNGKCLIVGWKGTPIHSLSAWK 628
                  ******************************************************9*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.475238608IPR005202Transcription factor GRAS
PfamPF035149.4E-82265628IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MANAFFSFTP FDFGVVGGGG GLTRQLEDYE KEDQEVVVFK GKPEHLFGME ELGLGEMEKF  60
SHLSKDQPQS KTSYSMLDNF SFDTVCSEHD LQRSNNMSEK ELDHVSKDHD HRHYQQQNQR  120
CQQQSKSNYS DLDNFNFDSP FHSTQPIQDM ANQLTYSQIG GSDIAETNKQ MPHQSSLAVL  180
ELLNNYGSAF KKLKRDRFSN SCNEAGASSY SIQQKLSTEE IMRVAGARYV QFSNQGYDDF  240
FMPLHPFGYA LSGLSEEETK DVELAHILLA AAEKVGYQQF ERANRLLLRC EFAASFKVNP  300
VQRVVFNFAE ALRERIEKET GNSMYKGNEI SSYSLGLSTN LTFIACHQDI PFHPVLQFAA  360
IQVILENVAL ERKVHLIDLE IRSGVQWTGL MEVLAEREEC PIELLTITAV GVTGKQKIEE  420
TGRRLASVAK ALNVPFQFKA VIVADMEDVK KQLFDVEDDE AVVVYAPLIL RTLILRPSCL  480
ENLMRVMRNL SPCVMVVNEV EANHNSPSFV NRFIDALFYY SAFFDCLEAC MKHEESRLLM  540
ERLLHEGIRN IVAAEGSERV TRNVKMEVWR AFFARFRMVE INFSKASLNQ ASLVAKKFGS  600
PSCTLHRNGK CLIVGWKGTP IHSLSAWKFR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2929362832375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346627.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5VUD50.0M5VUD5_PRUPE; Uncharacterized protein
STRINGVIT_07s0005g01500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.16e-50RGA-like 1